Brand: | Abnova |
Reference: | H00004487-M11 |
Product name: | MSX1 monoclonal antibody (M11), clone 1E2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSX1. |
Clone: | 1E2 |
Isotype: | IgG2a Kappa |
Gene id: | 4487 |
Gene name: | MSX1 |
Gene alias: | HOX7|HYD1 |
Gene description: | msh homeobox 1 |
Genbank accession: | NM_002448 |
Immunogen: | MSX1 (NP_002439, 216 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT |
Protein accession: | NP_002439 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004487-M11-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004487-M11-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.02 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00004487-M11-31-15-1.jpg](http://www.abnova.com/application_image/H00004487-M11-31-15-1.jpg) |
Application image note: | Immunoprecipitation of MSX1 transfected lysate using anti-MSX1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MSX1 MaxPab rabbit polyclonal antibody. |
Applications: | WB-Ce,IF,ELISA,WB-Re,IP |
Shipping condition: | Dry Ice |