MSX1 monoclonal antibody (M04), clone 3A8 View larger

MSX1 monoclonal antibody (M04), clone 3A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSX1 monoclonal antibody (M04), clone 3A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about MSX1 monoclonal antibody (M04), clone 3A8

Brand: Abnova
Reference: H00004487-M04
Product name: MSX1 monoclonal antibody (M04), clone 3A8
Product description: Mouse monoclonal antibody raised against a full length recombinant MSX1.
Clone: 3A8
Isotype: IgG2a Kappa
Gene id: 4487
Gene name: MSX1
Gene alias: HOX7|HYD1
Gene description: msh homeobox 1
Genbank accession: NM_002448
Immunogen: MSX1 (NP_002439, 216 a.a. ~ 297 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Protein accession: NP_002439
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004487-M04-31-15-1.jpg
Application image note: Immunoprecipitation of MSX1 transfected lysate using anti-MSX1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with MSX1 MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy MSX1 monoclonal antibody (M04), clone 3A8 now

Add to cart