MSX1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

H00004487-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Tr

More info about MSX1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004487-D01P
Product name: MSX1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MSX1 protein.
Gene id: 4487
Gene name: MSX1
Gene alias: HOX7|HYD1
Gene description: msh homeobox 1
Genbank accession: NM_002448.2
Immunogen: MSX1 (AAH67353.1, 1 a.a. ~ 297 a.a) full-length human protein.
Immunogen sequence/protein sequence: MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Protein accession: AAH67353.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004487-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MSX1 expression in transfected 293T cell line (H00004487-T01) by MSX1 MaxPab polyclonal antibody.

Lane 1: MSX1 transfected lysate(30.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MSX1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart