Brand: | Abnova |
Reference: | H00004486-M09 |
Product name: | MST1R monoclonal antibody (M09), clone 2F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MST1R. |
Clone: | 2F3 |
Isotype: | IgG2a Kappa |
Gene id: | 4486 |
Gene name: | MST1R |
Gene alias: | CD136|CDw136|PTK8|RON |
Gene description: | macrophage stimulating 1 receptor (c-met-related tyrosine kinase) |
Genbank accession: | NM_002447 |
Immunogen: | MST1R (NP_002438, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL |
Protein accession: | NP_002438 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | |
Application image note: | Detection limit for recombinant GST tagged MST1R is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |