MST1R monoclonal antibody (M05), clone 1H8 View larger

MST1R monoclonal antibody (M05), clone 1H8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MST1R monoclonal antibody (M05), clone 1H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MST1R monoclonal antibody (M05), clone 1H8

Brand: Abnova
Reference: H00004486-M05
Product name: MST1R monoclonal antibody (M05), clone 1H8
Product description: Mouse monoclonal antibody raised against a partial recombinant MST1R.
Clone: 1H8
Isotype: IgG2a Kappa
Gene id: 4486
Gene name: MST1R
Gene alias: CD136|CDw136|PTK8|RON
Gene description: macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
Genbank accession: NM_002447
Immunogen: MST1R (NP_002438, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVL
Protein accession: NP_002438
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004486-M05-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MST1R is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MST1R monoclonal antibody (M05), clone 1H8 now

Add to cart