Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSRA monoclonal antibody (M01A), clone 3C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MSRA monoclonal antibody (M01A), clone 3C11
| Brand: | Abnova |
| Reference: | H00004482-M01A |
| Product name: | MSRA monoclonal antibody (M01A), clone 3C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MSRA. |
| Clone: | 3C11 |
| Isotype: | IgG IgA IgM Mix Lambda |
| Gene id: | 4482 |
| Gene name: | MSRA |
| Gene alias: | - |
| Gene description: | methionine sulfoxide reductase A |
| Genbank accession: | NM_012331 |
| Immunogen: | MSRA (NP_036463.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYT |
| Protein accession: | NP_036463.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |