MSR1 monoclonal antibody (M02), clone 2G9 View larger

MSR1 monoclonal antibody (M02), clone 2G9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSR1 monoclonal antibody (M02), clone 2G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MSR1 monoclonal antibody (M02), clone 2G9

Brand: Abnova
Reference: H00004481-M02
Product name: MSR1 monoclonal antibody (M02), clone 2G9
Product description: Mouse monoclonal antibody raised against a partial recombinant MSR1.
Clone: 2G9
Isotype: IgG3 Kappa
Gene id: 4481
Gene name: MSR1
Gene alias: CD204|SCARA1|SR-A|phSR1|phSR2
Gene description: macrophage scavenger receptor 1
Genbank accession: NM_138715
Immunogen: MSR1 (NP_619729, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLKERVY
Protein accession: NP_619729
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004481-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004481-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MSR1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MSR1 monoclonal antibody (M02), clone 2G9 now

Add to cart