Brand: | Abnova |
Reference: | H00004478-M13 |
Product name: | MSN monoclonal antibody (M13), clone 4B8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSN. |
Clone: | 4B8 |
Isotype: | IgG2a Kappa |
Gene id: | 4478 |
Gene name: | MSN |
Gene alias: | - |
Gene description: | moesin |
Genbank accession: | NM_002444 |
Immunogen: | MSN (NP_002435, 422 a.a. ~ 531 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQDEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELAN |
Protein accession: | NP_002435 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004478-M13-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004478-M13-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004478-M13-3-5-1-L.jpg](http://www.abnova.com/application_image/H00004478-M13-3-5-1-L.jpg) |
Application image note: | Immunoperoxidase of monoclonal antibody to MSN on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |