Brand: | Abnova |
Reference: | H00004477-A01 |
Product name: | MSMB polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant MSMB. |
Gene id: | 4477 |
Gene name: | MSMB |
Gene alias: | HPC13|IGBF|MSP|MSPB|PN44|PRPS|PSP|PSP-94|PSP57|PSP94 |
Gene description: | microseminoprotein, beta- |
Genbank accession: | BC005257 |
Immunogen: | MSMB (AAH05257.1, 1 a.a. ~ 114 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
Protein accession: | AAH05257.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004477-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004477-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (38.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | EXTRACELLULAR AND MEMBRANE-ASSOCIATED PROSTATE CANCER MARKERSKlee, George G. ;Vasmatzis, George;Kosari, Farhad;Klee, Eric W. FreshPatents.com |