MSI1 monoclonal antibody (M10), clone 3E4 View larger

MSI1 monoclonal antibody (M10), clone 3E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSI1 monoclonal antibody (M10), clone 3E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA,WB-Re

More info about MSI1 monoclonal antibody (M10), clone 3E4

Brand: Abnova
Reference: H00004440-M10
Product name: MSI1 monoclonal antibody (M10), clone 3E4
Product description: Mouse monoclonal antibody raised against a full length recombinant MSI1.
Clone: 3E4
Isotype: IgG2a Kappa
Gene id: 4440
Gene name: MSI1
Gene alias: -
Gene description: musashi homolog 1 (Drosophila)
Genbank accession: NM_002442
Immunogen: MSI1 (NP_002433, 190 a.a. ~ 273 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPM
Protein accession: NP_002433
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004440-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.24 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004440-M10-3-46-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MSI1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MSI1 monoclonal antibody (M10), clone 3E4 now

Add to cart