Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSH5 monoclonal antibody (M08), clone 1C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about MSH5 monoclonal antibody (M08), clone 1C11
| Brand: | Abnova |
| Reference: | H00004439-M08 |
| Product name: | MSH5 monoclonal antibody (M08), clone 1C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MSH5. |
| Clone: | 1C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4439 |
| Gene name: | MSH5 |
| Gene alias: | DKFZp434C1615|G7|MGC2939|MutSH5|NG23 |
| Gene description: | mutS homolog 5 (E. coli) |
| Genbank accession: | BC002498 |
| Immunogen: | MSH5 (AAH02498, 736 a.a. ~ 835 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL |
| Protein accession: | AAH02498 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MSH5 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Spermatogenesis-specific association of SMCY and MSH5.Akimoto C, Kitagawa H, Matsumoto T, Kato S. Genes Cells. 2008 Jun;13(6):623-33. Epub 2008 May 4. |