Brand: | Abnova |
Reference: | H00004439-M08 |
Product name: | MSH5 monoclonal antibody (M08), clone 1C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSH5. |
Clone: | 1C11 |
Isotype: | IgG2a Kappa |
Gene id: | 4439 |
Gene name: | MSH5 |
Gene alias: | DKFZp434C1615|G7|MGC2939|MutSH5|NG23 |
Gene description: | mutS homolog 5 (E. coli) |
Genbank accession: | BC002498 |
Immunogen: | MSH5 (AAH02498, 736 a.a. ~ 835 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GNDLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEVSDLIRSGKPIKPVKDLLKKNQMENCQTLVDKFMKLDLEDPNLDLNVFMSQEVLPAATSIL |
Protein accession: | AAH02498 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004439-M08-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004439-M08-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004439-M08-9-21-1.jpg](http://www.abnova.com/application_image/H00004439-M08-9-21-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged MSH5 is approximately 0.1ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Spermatogenesis-specific association of SMCY and MSH5.Akimoto C, Kitagawa H, Matsumoto T, Kato S. Genes Cells. 2008 Jun;13(6):623-33. Epub 2008 May 4. |