Brand: | Abnova |
Reference: | H00004438-A01 |
Product name: | MSH4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MSH4. |
Gene id: | 4438 |
Gene name: | MSH4 |
Gene alias: | - |
Gene description: | mutS homolog 4 (E. coli) |
Genbank accession: | NM_002440 |
Immunogen: | MSH4 (NP_002431, 831 a.a. ~ 936 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | YKLSKGLTEEKNYGLKAAEVSSLPPSIVLDAKEITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIYLSNLKKKYKEDFPRTEQVPEKTEE |
Protein accession: | NP_002431 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004438-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004438-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.77 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |