Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004436-M03 |
Product name: | MSH2 monoclonal antibody (M03), clone 3E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSH2. |
Clone: | 3E7 |
Isotype: | IgG2a Kappa |
Gene id: | 4436 |
Gene name: | MSH2 |
Gene alias: | COCA1|FCC1|HNPCC|HNPCC1|LCFS2 |
Gene description: | mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
Genbank accession: | BC021566 |
Immunogen: | MSH2 (AAH21566, 835 a.a. ~ 934 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT |
Protein accession: | AAH21566 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of MSH2 expression in transfected 293T cell line by MSH2 monoclonal antibody (M03), clone 3E7. Lane 1: MSH2 transfected lysate (Predicted MW: 104.7 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |