Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MSH2 monoclonal antibody (M02), clone 4B2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
More info about MSH2 monoclonal antibody (M02), clone 4B2
| Brand: | Abnova |
| Reference: | H00004436-M02 |
| Product name: | MSH2 monoclonal antibody (M02), clone 4B2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MSH2. |
| Clone: | 4B2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4436 |
| Gene name: | MSH2 |
| Gene alias: | COCA1|FCC1|HNPCC|HNPCC1|LCFS2 |
| Gene description: | mutS homolog 2, colon cancer, nonpolyposis type 1 (E. coli) |
| Genbank accession: | BC021566 |
| Immunogen: | MSH2 (AAH21566, 835 a.a. ~ 934 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NFPKHVIECAKQKALELEEFQYIGESQGYDIMEPAAKKCYLEREQGEKIIQEFLSKVKQMPFTEMSEENITIKLKQLKAEVIAKNNSFVNEIISRIKVTT |
| Protein accession: | AAH21566 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Proximity Ligation Analysis of protein-protein interactions between MAX and MSH2. HeLa cells were stained with anti-MAX rabbit purified polyclonal 1:1200 and anti-MSH2 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |