CITED1 monoclonal antibody (M01), clone 6G8 View larger

CITED1 monoclonal antibody (M01), clone 6G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CITED1 monoclonal antibody (M01), clone 6G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about CITED1 monoclonal antibody (M01), clone 6G8

Brand: Abnova
Reference: H00004435-M01
Product name: CITED1 monoclonal antibody (M01), clone 6G8
Product description: Mouse monoclonal antibody raised against a partial recombinant CITED1.
Clone: 6G8
Isotype: IgG2a Kappa
Gene id: 4435
Gene name: CITED1
Gene alias: MSG1
Gene description: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Genbank accession: NM_004143
Immunogen: CITED1 (NP_004134, 94 a.a. ~ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC
Protein accession: NP_004134
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004435-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00004435-M01-1-4-1.jpg
Application image note: CITED1 monoclonal antibody (M01), clone 6G8 Western Blot analysis of CITED1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy CITED1 monoclonal antibody (M01), clone 6G8 now

Add to cart