Brand: | Abnova |
Reference: | H00004363-M01 |
Product name: | ABCC1 monoclonal antibody (M01), clone 1G8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCC1. |
Clone: | 1G8 |
Isotype: | IgG1 Kappa |
Gene id: | 4363 |
Gene name: | ABCC1 |
Gene alias: | ABC29|ABCC|DKFZp686N04233|DKFZp781G125|GS-X|MRP|MRP1 |
Gene description: | ATP-binding cassette, sub-family C (CFTR/MRP), member 1 |
Genbank accession: | NM_004996 |
Immunogen: | ABCC1 (NP_004987, 816 a.a. ~ 915 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLKNKTRILVTHSMSYLPQVDVIIVMSGGKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLS |
Protein accession: | NP_004987 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004363-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004363-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |