Brand: | Abnova |
Reference: | H00004359-A01 |
Product name: | MPZ polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant MPZ. |
Gene id: | 4359 |
Gene name: | MPZ |
Gene alias: | CHM|CMT1|CMT1B|CMT2I|CMT2J|CMT4E|CMTDI3|DSS|HMSNIB|MPP|P0 |
Gene description: | myelin protein zero |
Genbank accession: | BC006491 |
Immunogen: | MPZ (AAH06491.1, 1 a.a. ~ 258 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MLRAPAPAPAMAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREAHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK |
Protein accession: | AAH06491.1 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004359-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004359-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (54.49 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | BDNF Exerts Contrasting Effects on Peripheral Myelination of NGF-Dependent and BDNF-Dependent DRG Neurons.Xiao J, Wong AW, Willingham MM, Kaasinen SK, Hendry IA, Howitt J, Putz U, Barrett GL, Kilpatrick TJ, Murray SS. J Neurosci. 2009 Apr 1;29(13):4016-22. |