MPST (Human) Recombinant Protein (P01) View larger

MPST (Human) Recombinant Protein (P01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPST (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about MPST (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00004357-P01
Product name: MPST (Human) Recombinant Protein (P01)
Product description: Human MPST full-length ORF ( NP_066949.1, 1 a.a. - 297 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 4357
Gene name: MPST
Gene alias: MGC24539|MST|TST2
Gene description: mercaptopyruvate sulfurtransferase
Genbank accession: NM_021126.4
Immunogen sequence/protein sequence: MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Protein accession: NP_066949.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00004357-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Endogenously produced hydrogen sulfide is involved in porcine oocyte maturation in vitro.Nevoral J, Zalmanova T, Zamostna K, Kott T, Kucerova-Chrpova V, Bodart JF, Gelaude A, Prochazka R, Orsak M, Sulc M, Klein P, Dvorakova M, Weingartova I, Vighova A, Hoskova K, Krejcova T, Jilek F, Petr J.
Nitric Oxide. 2015 Oct 9;51:24-35.

Reviews

Buy MPST (Human) Recombinant Protein (P01) now

Add to cart