MPST monoclonal antibody (M01), clone 1B5 View larger

MPST monoclonal antibody (M01), clone 1B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPST monoclonal antibody (M01), clone 1B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,IP

More info about MPST monoclonal antibody (M01), clone 1B5

Brand: Abnova
Reference: H00004357-M01
Product name: MPST monoclonal antibody (M01), clone 1B5
Product description: Mouse monoclonal antibody raised against a partial recombinant MPST.
Clone: 1B5
Isotype: IgG1 Kappa
Gene id: 4357
Gene name: MPST
Gene alias: MGC24539|MST|TST2
Gene description: mercaptopyruvate sulfurtransferase
Genbank accession: NM_001013436
Immunogen: MPST (NP_001013454.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY
Protein accession: NP_001013454.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004357-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MPST is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy MPST monoclonal antibody (M01), clone 1B5 now

Add to cart