Brand: | Abnova |
Reference: | H00004357-M01 |
Product name: | MPST monoclonal antibody (M01), clone 1B5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MPST. |
Clone: | 1B5 |
Isotype: | IgG1 Kappa |
Gene id: | 4357 |
Gene name: | MPST |
Gene alias: | MGC24539|MST|TST2 |
Gene description: | mercaptopyruvate sulfurtransferase |
Genbank accession: | NM_001013436 |
Immunogen: | MPST (NP_001013454.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIY |
Protein accession: | NP_001013454.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MPST is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |