MPST purified MaxPab rabbit polyclonal antibody (D01P) View larger

MPST purified MaxPab rabbit polyclonal antibody (D01P)

H00004357-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPST purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about MPST purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004357-D01P
Product name: MPST purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MPST protein.
Gene id: 4357
Gene name: MPST
Gene alias: MGC24539|MST|TST2
Gene description: mercaptopyruvate sulfurtransferase
Genbank accession: NM_021126.4
Immunogen: MPST (NP_066949.1, 1 a.a. ~ 297 a.a) full-length human protein.
Immunogen sequence/protein sequence: MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTSPYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNLPLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVNIPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWYMRARPEDVISEGRGKTH
Protein accession: NP_066949.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004357-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MPST expression in transfected 293T cell line (H00004357-T02) by MPST MaxPab polyclonal antibody.

Lane 1: MPST transfected lysate(33.20 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MPST purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart