Brand: | Abnova |
Reference: | H00004354-M03 |
Product name: | MPP1 monoclonal antibody (M03), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MPP1. |
Clone: | 2E5 |
Isotype: | IgG2a Kappa |
Gene id: | 4354 |
Gene name: | MPP1 |
Gene alias: | AAG12|DXS552|DXS552E|EMP55|MRG1|PEMP |
Gene description: | membrane protein, palmitoylated 1, 55kDa |
Genbank accession: | NM_002436 |
Immunogen: | MPP1 (NP_002427, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MTLKASEGESGGSMHTALSDLYLEHLLQKRSRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVKGQEVRKVRLIQFEKVTEEPMGITLKLNEKQSCTVAR |
Protein accession: | NP_002427 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MPP1 monoclonal antibody (M03), clone 2E5. Western Blot analysis of MPP1 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |