MPG monoclonal antibody (M06), clone 2D2 View larger

MPG monoclonal antibody (M06), clone 2D2

H00004350-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MPG monoclonal antibody (M06), clone 2D2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about MPG monoclonal antibody (M06), clone 2D2

Brand: Abnova
Reference: H00004350-M06
Product name: MPG monoclonal antibody (M06), clone 2D2
Product description: Mouse monoclonal antibody raised against a partial recombinant MPG.
Clone: 2D2
Isotype: IgG2a Kappa
Gene id: 4350
Gene name: MPG
Gene alias: AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg
Gene description: N-methylpurine-DNA glycosylase
Genbank accession: BC014991
Immunogen: MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA
Protein accession: AAH14991
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004350-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004350-M06-1-25-1.jpg
Application image note: MPG monoclonal antibody (M06), clone 2D2 Western Blot analysis of MPG expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MPG monoclonal antibody (M06), clone 2D2 now

Add to cart