Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MPG monoclonal antibody (M04), clone 1E10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about MPG monoclonal antibody (M04), clone 1E10
| Brand: | Abnova |
| Reference: | H00004350-M04 |
| Product name: | MPG monoclonal antibody (M04), clone 1E10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MPG. |
| Clone: | 1E10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4350 |
| Gene name: | MPG |
| Gene alias: | AAG|APNG|CRA36.1|MDG|Mid1|PIG11|PIG16|anpg |
| Gene description: | N-methylpurine-DNA glycosylase |
| Genbank accession: | BC014991 |
| Immunogen: | MPG (AAH14991, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPARSGAQFCRRMGQKKQRPARAGQPHSSSDAAQAPAEQPHSSSDAAQAPCPRERCLGPPTTPGPYRSIYFSSPKGHLTRLGLEFFDQPA |
| Protein accession: | AAH14991 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MPG on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Chk2-dependent phosphorylation of XRCC1 in the DNA damage response promotes base excision repair.Chou WC, Wang HC, Wong FH, Ding SL, Wu PE, Shieh SY, Shen CY. EMBO J. 2008 Dec 3;27(23):3140-50. Epub 2008 Oct 30. |