MOS MaxPab rabbit polyclonal antibody (D01) View larger

MOS MaxPab rabbit polyclonal antibody (D01)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MOS MaxPab rabbit polyclonal antibody (D01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr,IP

More info about MOS MaxPab rabbit polyclonal antibody (D01)

Brand: Abnova
Reference: H00004342-D01
Product name: MOS MaxPab rabbit polyclonal antibody (D01)
Product description: Rabbit polyclonal antibody raised against a full-length human MOS protein.
Gene id: 4342
Gene name: MOS
Gene alias: MGC119962|MGC119963|MSV
Gene description: v-mos Moloney murine sarcoma viral oncogene homolog
Genbank accession: NM_005372.1
Immunogen: MOS (NP_005363.1, 1 a.a. ~ 346 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLKYSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
Protein accession: NP_005363.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004342-D01-2-A7-1.jpg
Application image note: MOS MaxPab rabbit polyclonal antibody. Western Blot analysis of MOS expression in human pancreas.
Applications: WB-Ti,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy MOS MaxPab rabbit polyclonal antibody (D01) now

Add to cart