Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MOBP monoclonal antibody (M02A), clone 2F5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MOBP monoclonal antibody (M02A), clone 2F5
| Brand: | Abnova |
| Reference: | H00004336-M02A |
| Product name: | MOBP monoclonal antibody (M02A), clone 2F5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MOBP. |
| Clone: | 2F5 |
| Isotype: | IgM Kappa |
| Gene id: | 4336 |
| Gene name: | MOBP |
| Gene alias: | MGC87379 |
| Gene description: | myelin-associated oligodendrocyte basic protein |
| Genbank accession: | BC022471 |
| Immunogen: | MOBP (AAH22471, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK |
| Protein accession: | AAH22471 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |