Brand: | Abnova |
Reference: | H00004336-M01A |
Product name: | MOBP monoclonal antibody (M01A), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MOBP. |
Clone: | 1H3 |
Isotype: | IgM Kappa |
Gene id: | 4336 |
Gene name: | MOBP |
Gene alias: | MGC87379 |
Gene description: | myelin-associated oligodendrocyte basic protein |
Genbank accession: | BC022471 |
Immunogen: | MOBP (AAH22471, 1 a.a. ~ 81 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK |
Protein accession: | AAH22471 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |