MMP13 purified MaxPab rabbit polyclonal antibody (D01P) View larger

MMP13 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MMP13 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Tr

More info about MMP13 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004322-D01P
Product name: MMP13 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MMP13 protein.
Gene id: 4322
Gene name: MMP13
Gene alias: CLG3
Gene description: matrix metallopeptidase 13 (collagenase 3)
Genbank accession: NM_002427
Immunogen: MMP13 (NP_002418.1, 1 a.a. ~ 471 a.a) full-length human protein.
Immunogen sequence/protein sequence: MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENAASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGYDILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC
Protein accession: NP_002418.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004322-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MMP13 expression in transfected 293T cell line (H00004322-T01) by MMP13 MaxPab polyclonal antibody.

Lane 1: MMP13 transfected lysate(53.80 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MMP13 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart