MLLT1 monoclonal antibody (M01), clone 3H2 View larger

MLLT1 monoclonal antibody (M01), clone 3H2

H00004298-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MLLT1 monoclonal antibody (M01), clone 3H2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about MLLT1 monoclonal antibody (M01), clone 3H2

Brand: Abnova
Reference: H00004298-M01
Product name: MLLT1 monoclonal antibody (M01), clone 3H2
Product description: Mouse monoclonal antibody raised against a partial recombinant MLLT1.
Clone: 3H2
Isotype: IgG2a Kappa
Gene id: 4298
Gene name: MLLT1
Gene alias: ENL|LTG19|YEATS1
Gene description: myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 1
Genbank accession: NM_005934
Immunogen: MLLT1 (NP_005925, 472 a.a. ~ 558 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GRRSPESCSKPEKILKKGTYDKAYTDELVELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKLQSCLEAVA
Protein accession: NP_005925
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004298-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004298-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MLLT1 is approximately 0.1ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MLLT1 monoclonal antibody (M01), clone 3H2 now

Add to cart