MICB purified MaxPab mouse polyclonal antibody (B01P) View larger

MICB purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MICB purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MICB purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004277-B01P
Product name: MICB purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MICB protein.
Gene id: 4277
Gene name: MICB
Gene alias: PERB11.2
Gene description: MHC class I polypeptide-related sequence B
Genbank accession: BC044218.1
Immunogen: MICB (AAH44218.1, 1 a.a. ~ 340 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGLGRVLLFLAVAFPFAPPAAAAEPHSLRYNLMVLSQDGSVQSGFLAEGHLDGQPFLRYDRQKRRAKPQGQWAEDVLGAETWDTETEDLTENGQDLRRTLTHIKDQKGVPQSSRAQTLAMNVTNFWKEDAMKTKTHYRAMQADCLQKLQRYLKSGVAIRRTVPPMVNVTCSEVSEGNITVTCRASSFYPRNITLTWRQDGVSLSHNTQQWGDVLPDGNGTYQTWVATRIRQGEEQRFTCYMEHSGNHGTHPVPSGKALVLQSQRTDFPYVSAAMPCFVIIIILCVPCCKKKTSAAEGPELVSLQVLDQHPVGTGDHRDAAQLGFQPLMSATGSTGSTEGA
Protein accession: AAH44218.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004277-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MICB expression in transfected 293T cell line (H00004277-T01) by MICB MaxPab polyclonal antibody.

Lane 1: MICB transfected lysate(37.4 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MICB purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart