MICA purified MaxPab mouse polyclonal antibody (B01P) View larger

MICA purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MICA purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MICA purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004276-B01P
Product name: MICA purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MICA protein.
Gene id: 4276
Gene name: MICA
Gene alias: FLJ60820|MGC111087|PERB11.1
Gene description: MHC class I polypeptide-related sequence A
Genbank accession: NM_000247.1
Immunogen: MICA (NP_000238.1, 1 a.a. ~ 383 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
Protein accession: NP_000238.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004276-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MICA expression in transfected 293T cell line (H00004276-T01) by MICA MaxPab polyclonal antibody.

Lane 1: MICA transfected lysate(42.13 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MICA purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart