Brand: | Abnova |
Reference: | H00004267-M01 |
Product name: | CD99 monoclonal antibody (M01), clone 3A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CD99. |
Clone: | 3A10 |
Isotype: | IgG2a Kappa |
Gene id: | 4267 |
Gene name: | CD99 |
Gene alias: | MIC2|MIC2X|MIC2Y |
Gene description: | CD99 molecule |
Genbank accession: | BC003147 |
Immunogen: | CD99 (AAH03147, 23 a.a. ~ 122 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEAD |
Protein accession: | AAH03147 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CD99 monoclonal antibody (M01), clone 3A10 Western Blot analysis of CD99 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |
Publications: | Orbital infantile myofibroma: a case report and clinicopathologic review of 24 cases from the literature.Mynatt CJ, Feldman KA, Thompson LD. Head Neck Pathol. 2011 Sep;5(3):205-15. Epub 2011 Apr 22. |