Brand: | Abnova |
Reference: | H00004261-A01 |
Product name: | MHC2TA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MHC2TA. |
Gene id: | 4261 |
Gene name: | CIITA |
Gene alias: | C2TA|CIITAIV|MHC2TA|NLRA |
Gene description: | class II, major histocompatibility complex, transactivator |
Genbank accession: | NM_000246 |
Immunogen: | MHC2TA (NP_000237, 39 a.a. ~ 148 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NSDADPLCLYHFYDQMDLAGEEEIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFKHIGPDEVIGESMEMPAEVGQKSQKRPFP |
Protein accession: | NP_000237 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |