MGST3 purified MaxPab rabbit polyclonal antibody (D01P) View larger

MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about MGST3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00004259-D01P
Product name: MGST3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human MGST3 protein.
Gene id: 4259
Gene name: MGST3
Gene alias: GST-III
Gene description: microsomal glutathione S-transferase 3
Genbank accession: NM_004528.2
Immunogen: MGST3 (NP_004519.1, 1 a.a. ~ 152 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH
Protein accession: NP_004519.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00004259-D01P-13-15-1.jpg
Application image note: Western Blot analysis of MGST3 expression in transfected 293T cell line (H00004259-T01) by MGST3 MaxPab polyclonal antibody.

Lane 1: MGST3 transfected lysate(16.50 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGST3 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart