Brand: | Abnova |
Reference: | H00004255-D01P |
Product name: | MGMT purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human MGMT protein. |
Gene id: | 4255 |
Gene name: | MGMT |
Gene alias: | - |
Gene description: | O-6-methylguanine-DNA methyltransferase |
Genbank accession: | NM_002412.2 |
Immunogen: | MGMT (NP_002403.1, 1 a.a. ~ 207 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN |
Protein accession: | NP_002403.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: | ![H00004255-D01P-2-C2-1.jpg](http://www.abnova.com/application_image/H00004255-D01P-2-C2-1.jpg) |
Application image note: | MGMT MaxPab rabbit polyclonal antibody. Western Blot analysis of MGMT expression in mouse liver. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |