MGMT purified MaxPab mouse polyclonal antibody (B01P) View larger

MGMT purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGMT purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about MGMT purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004255-B01P
Product name: MGMT purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MGMT protein.
Gene id: 4255
Gene name: MGMT
Gene alias: -
Gene description: O-6-methylguanine-DNA methyltransferase
Genbank accession: NM_002412.2
Immunogen: MGMT (NP_002403.1, 1 a.a. ~ 207 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDKDCEMKRTTLDSPLGKLELSGCEQGLHEIKLLGKGTSAADAVEVPAPAAVLGGPEPLMQCTAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISYQQLAALAGNPKAARAVGGAMRGNPVPILIPCHRVVCSSGAVGNYSGGLAVKEWLLAHEGHRLGKPGLGGSSGLAGAWLKGAGATSGSPPAGRN
Protein accession: NP_002403.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004255-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MGMT expression in transfected 293T cell line (H00004255-T01) by MGMT MaxPab polyclonal antibody.

Lane 1: MGMT transfected lysate(22.77 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGMT purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart