Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MGAT5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MGAT5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00004249-A01 |
| Product name: | MGAT5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant MGAT5. |
| Gene id: | 4249 |
| Gene name: | MGAT5 |
| Gene alias: | GNT-V|GNT-VA |
| Gene description: | mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase |
| Genbank accession: | NM_002410 |
| Immunogen: | MGAT5 (NP_002401, 642 a.a. ~ 739 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | LAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKD |
| Protein accession: | NP_002401 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.89 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Predominant expression of N-acetylglucosaminyltransferase V (GnT-V) in neural stem/progenitor cells.Hamanoue M, Ikeda Y, Ogata T, Takamatsu K. Stem Cell Research(2014), doi: 10.1016/j.scr.2014.11.004 |