Brand: | Abnova |
Reference: | H00004233-A01 |
Product name: | MET polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MET. |
Gene id: | 4233 |
Gene name: | MET |
Gene alias: | AUTS9|HGFR|RCCP2|c-Met |
Gene description: | met proto-oncogene (hepatocyte growth factor receptor) |
Genbank accession: | NM_000245 |
Immunogen: | MET (NM_000245, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | CKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEHHIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMALVVDTY |
Protein accession: | NM_000245 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |