MEOX1 monoclonal antibody (M23), clone 1F3 View larger

MEOX1 monoclonal antibody (M23), clone 1F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEOX1 monoclonal antibody (M23), clone 1F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about MEOX1 monoclonal antibody (M23), clone 1F3

Brand: Abnova
Reference: H00004222-M23
Product name: MEOX1 monoclonal antibody (M23), clone 1F3
Product description: Mouse monoclonal antibody raised against a full length recombinant MEOX1.
Clone: 1F3
Isotype: IgG2a Kappa
Gene id: 4222
Gene name: MEOX1
Gene alias: MOX1
Gene description: mesenchyme homeobox 1
Genbank accession: NM_004527
Immunogen: MEOX1 (NP_004518, 82 a.a. ~ 170 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSK*
Protein accession: NP_004518
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004222-M23-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.79 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004222-M23-1-35-1.jpg
Application image note: MEOX1 monoclonal antibody (M23), clone 1F3 Western Blot analysis of MEOX1 expression in Y-79 ( Cat # L042V1 ).
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MEOX1 monoclonal antibody (M23), clone 1F3 now

Add to cart