MEOX1 monoclonal antibody (M04J), clone 1D10 View larger

MEOX1 monoclonal antibody (M04J), clone 1D10

H00004222-M04J_50ug

New product

504,00 € tax excl.

50 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEOX1 monoclonal antibody (M04J), clone 1D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MEOX1 monoclonal antibody (M04J), clone 1D10

Brand: Abnova
Reference: H00004222-M04J
Product name: MEOX1 monoclonal antibody (M04J), clone 1D10
Product description: Mouse monoclonal antibody raised against a partial recombinant MEOX1.
Clone: 1D10
Isotype: IgG2a Kappa
Gene id: 4222
Gene name: MEOX1
Gene alias: MOX1
Gene description: mesenchyme homeobox 1
Genbank accession: NM_004527
Immunogen: MEOX1 (NP_004518.1, 165 a.a. ~ 252 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPS
Protein accession: NP_004518.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004222-M04J-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.42 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MEOX1 monoclonal antibody (M04J), clone 1D10 now

Add to cart