Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MAP3K5 monoclonal antibody (M06A), clone X1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about MAP3K5 monoclonal antibody (M06A), clone X1
| Brand: | Abnova |
| Reference: | H00004217-M06A |
| Product name: | MAP3K5 monoclonal antibody (M06A), clone X1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K5. |
| Clone: | X1 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4217 |
| Gene name: | MAP3K5 |
| Gene alias: | ASK1|MAPKKK5|MEKK5 |
| Gene description: | mitogen-activated protein kinase kinase kinase 5 |
| Genbank accession: | BC054503 |
| Immunogen: | MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
| Protein accession: | AAH54503 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.58 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | MAP3K5 monoclonal antibody (M06A), clone X1 Western Blot analysis of MAP3K5 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |