MAP3K5 monoclonal antibody (M01), clone 5C4 View larger

MAP3K5 monoclonal antibody (M01), clone 5C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K5 monoclonal antibody (M01), clone 5C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about MAP3K5 monoclonal antibody (M01), clone 5C4

Brand: Abnova
Reference: H00004217-M01
Product name: MAP3K5 monoclonal antibody (M01), clone 5C4
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K5.
Clone: 5C4
Isotype: IgG2b Kappa
Gene id: 4217
Gene name: MAP3K5
Gene alias: ASK1|MAPKKK5|MEKK5
Gene description: mitogen-activated protein kinase kinase kinase 5
Genbank accession: BC054503
Immunogen: MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT
Protein accession: AAH54503
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004217-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (41.58 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004217-M01-1-12-1.jpg
Application image note: MAP3K5 monoclonal antibody (M01), clone 5C4 Western Blot analysis of MAP3K5 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAP3K5 monoclonal antibody (M01), clone 5C4 now

Add to cart