Brand: | Abnova |
Reference: | H00004217-M01 |
Product name: | MAP3K5 monoclonal antibody (M01), clone 5C4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K5. |
Clone: | 5C4 |
Isotype: | IgG2b Kappa |
Gene id: | 4217 |
Gene name: | MAP3K5 |
Gene alias: | ASK1|MAPKKK5|MEKK5 |
Gene description: | mitogen-activated protein kinase kinase kinase 5 |
Genbank accession: | BC054503 |
Immunogen: | MAP3K5 (AAH54503, 1231 a.a. ~ 1374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SHDSQSAHRSLNVQLGRMKIETNRLLEELVRKEKELQALLHRAIEEKDQEIKHLKLKSQPIEIPELPVFHLNSSGTNTEDSELTDWLRVNGADEDTISRFLAEDYTLLDVLYYVTRDDLKCLRLRGGMLCTLWKAIIDFRNKQT |
Protein accession: | AAH54503 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (41.58 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MAP3K5 monoclonal antibody (M01), clone 5C4 Western Blot analysis of MAP3K5 expression in HepG2 ( Cat # L019V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |