Brand: | Abnova |
Reference: | H00004216-M11A |
Product name: | MAP3K4 monoclonal antibody (M11A), clone X1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP3K4. |
Clone: | X1 |
Isotype: | IgG2b |
Gene id: | 4216 |
Gene name: | MAP3K4 |
Gene alias: | FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412 |
Gene description: | mitogen-activated protein kinase kinase kinase 4 |
Genbank accession: | NM_005922 |
Immunogen: | MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS |
Protein accession: | NP_005913 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | MAP3K4 monoclonal antibody (M11A), clone X1 Western Blot analysis of MAP3K4 expression in NIH/3T3. |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |