MAP3K4 monoclonal antibody (M08), clone 4F10 View larger

MAP3K4 monoclonal antibody (M08), clone 4F10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K4 monoclonal antibody (M08), clone 4F10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about MAP3K4 monoclonal antibody (M08), clone 4F10

Brand: Abnova
Reference: H00004216-M08
Product name: MAP3K4 monoclonal antibody (M08), clone 4F10
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
Clone: 4F10
Isotype: IgG1 Kappa
Gene id: 4216
Gene name: MAP3K4
Gene alias: FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412
Gene description: mitogen-activated protein kinase kinase kinase 4
Genbank accession: NM_005922
Immunogen: MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Protein accession: NP_005913
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004216-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004216-M08-3-36-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MAP3K4 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MAP3K4 monoclonal antibody (M08), clone 4F10 now

Add to cart