MAP3K4 monoclonal antibody (M06), clone 6A12 View larger

MAP3K4 monoclonal antibody (M06), clone 6A12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP3K4 monoclonal antibody (M06), clone 6A12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,PLA-Ce

More info about MAP3K4 monoclonal antibody (M06), clone 6A12

Brand: Abnova
Reference: H00004216-M06
Product name: MAP3K4 monoclonal antibody (M06), clone 6A12
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP3K4.
Clone: 6A12
Isotype: IgG1 Kappa
Gene id: 4216
Gene name: MAP3K4
Gene alias: FLJ42439|KIAA0213|MAPKKK4|MEKK4|MTK1|PRO0412
Gene description: mitogen-activated protein kinase kinase kinase 4
Genbank accession: NM_005922
Immunogen: MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
Protein accession: NP_005913
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004216-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004216-M06-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MAP3K4 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy MAP3K4 monoclonal antibody (M06), clone 6A12 now

Add to cart