Brand: | Abnova |
Reference: | H00004212-M03 |
Product name: | MEIS2 monoclonal antibody (M03), clone 1D1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MEIS2. |
Clone: | 1D1 |
Isotype: | IgG1 Kappa |
Gene id: | 4212 |
Gene name: | MEIS2 |
Gene alias: | HsT18361|MGC2820|MRG1 |
Gene description: | Meis homeobox 2 |
Genbank accession: | BC001516 |
Immunogen: | MEIS2 (AAH01516, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM |
Protein accession: | AAH01516 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (67.65 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MEIS2 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |