MEIS2 monoclonal antibody (M02), clone 1B3 View larger

MEIS2 monoclonal antibody (M02), clone 1B3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEIS2 monoclonal antibody (M02), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MEIS2 monoclonal antibody (M02), clone 1B3

Brand: Abnova
Reference: H00004212-M02
Product name: MEIS2 monoclonal antibody (M02), clone 1B3
Product description: Mouse monoclonal antibody raised against a full-length recombinant MEIS2.
Clone: 1B3
Isotype: IgG2b Kappa
Gene id: 4212
Gene name: MEIS2
Gene alias: HsT18361|MGC2820|MRG1
Gene description: Meis homeobox 2
Genbank accession: BC001516
Immunogen: MEIS2 (AAH01516, 1 a.a. ~ 381 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGAAYSPEGQPMGSFVLDGQQHMGIRPAGPMSGMGMNMGMDGQWHYM
Protein accession: AAH01516
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004212-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (67.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004212-M02-1-19-1.jpg
Application image note: MEIS2 monoclonal antibody (M02), clone 1B3. Western Blot analysis of MEIS2 expression in IMR-32.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MEIS2 monoclonal antibody (M02), clone 1B3 now

Add to cart