Brand: | Abnova |
Reference: | H00004210-A01 |
Product name: | MEFV polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant MEFV. |
Gene id: | 4210 |
Gene name: | MEFV |
Gene alias: | FMF|MEF|MGC126560|MGC126586|TRIM20 |
Gene description: | Mediterranean fever |
Genbank accession: | NM_000243 |
Immunogen: | MEFV (NP_000234, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTYYGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSL |
Protein accession: | NP_000234 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The effect of colchicine on pyrin and pyrin interacting proteins.Taskiran EZ, Cetinkaya A, Balci-Peynircioglu B, Akkaya YZ, Yilmaz E. J Cell Biochem. 2012 Jun 21. doi: 10.1002/jcb.24231. |