MEF2D monoclonal antibody (M03), clone 1B8 View larger

MEF2D monoclonal antibody (M03), clone 1B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MEF2D monoclonal antibody (M03), clone 1B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MEF2D monoclonal antibody (M03), clone 1B8

Brand: Abnova
Reference: H00004209-M03
Product name: MEF2D monoclonal antibody (M03), clone 1B8
Product description: Mouse monoclonal antibody raised against a partial recombinant MEF2D.
Clone: 1B8
Isotype: IgG2b Kappa
Gene id: 4209
Gene name: MEF2D
Gene alias: DKFZp686I1536
Gene description: myocyte enhancer factor 2D
Genbank accession: NM_005920
Immunogen: MEF2D (NP_005911.1, 256 a.a. ~ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS
Protein accession: NP_005911.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004209-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.56 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004209-M03-1-9-1.jpg
Application image note: MEF2D monoclonal antibody (M03), clone 1B8 Western Blot analysis of MEF2D expression in K-562 ( Cat # L009V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MEF2D monoclonal antibody (M03), clone 1B8 now

Add to cart