Brand: | Abnova |
Reference: | H00004209-M02 |
Product name: | MEF2D monoclonal antibody (M02), clone 3A11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MEF2D. |
Clone: | 3A11 |
Isotype: | IgG2a Kappa |
Gene id: | 4209 |
Gene name: | MEF2D |
Gene alias: | DKFZp686I1536 |
Gene description: | myocyte enhancer factor 2D |
Genbank accession: | NM_005920 |
Immunogen: | MEF2D (NP_005911.1, 256 a.a. ~ 351 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | THSTQLGAPSRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLTSAELSSLPAFS |
Protein accession: | NP_005911.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.56 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MEF2D monoclonal antibody (M02), clone 3A11 Western Blot analysis of MEF2D expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |