Brand: | Abnova |
Reference: | H00004207-M24 |
Product name: | MEF2B monoclonal antibody (M24), clone 4B5 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MEF2B. |
Clone: | 4B5 |
Isotype: | IgG2a Kappa |
Gene id: | 4207 |
Gene name: | MEF2B |
Gene alias: | FLJ32599|FLJ46391|MGC189732|MGC189763|RSRFR2 |
Gene description: | myocyte enhancer factor 2B |
Genbank accession: | NM_005919 |
Immunogen: | MEF2B (NP_005910.1, 165 a.a. ~ 235 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRPSPFRPAAPKAGPPGLVHPLFSPSHLTSKTPPPLYLPTEGRRSDLPGGLAGPRGGLNTSRSLYSGLQNP |
Protein accession: | NP_005910.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MEF2B monoclonal antibody (M24), clone 4B5. Western Blot analysis of MEF2B expression in human stomach. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |